
Western blot - Anti-KCNH1 Picoband antibody
Kv10.1 / KCNH1 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C662689-100
Catalog Number: LS-C662689
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- KCNH1 antibody LS-C662689 is an unconjugated rabbit polyclonal antibody to human KCNH1 (Kv10.1). Validated for WB.
- Application
- WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- EAG1 | EAG | EAG channel 1 | HEAG1 | H-eag | KCNH1 | Kv10.1
- UniProt Number
- O95259
- NCBI GenBank
- NM_002238 | NP_002229.1
- SwissProt
- O95259
Target
- Target
- Human Kv10.1 / KCNH1
- Antigen Species
- Human
- Epitope
- Highly expressed in brain and in myoblasts at the onset of fusion, but not in other tissues. Detected in HeLa (cervical carcinoma), SH-SY5Y (neuroblastoma) and MCF-7 (epithelial tumor) cells, but not in normal epithelial cells.
- Gene Name
- KCNH1
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence of human KCNH1 (AKRKSWARFKDACGKSEDWNKVSKAESMETLPERTKA).
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
- Preservative
- Yes
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl
