
Western blot - Anti-Cytokeratin 5 Picoband Antibody
KRT5 / CK5 / Cytokeratin 5 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Human |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C661966-100
Catalog Number: LS-C661966
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Cytokeratin 5 antibody LS-C661966 is an unconjugated rabbit polyclonal antibody to human Cytokeratin 5 (KRT5 / CK5). Validated for IHC and WB.
- Application
- IHC, IHC-P, WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- 58 kd cytokeratin | 58 kDa cytokeratin | CK5 | CK-5 | Cytokeratin-5 | DDD | EBS2 | Keratin 5 | KRT5A | KRT5 | Type-II keratin Kb5 | Cytokeratin 5 | K5 | Keratin-5
- UniProt Number
- P13647
- NCBI GenBank
- NM_000424 | NP_000415.2
- SwissProt
- P13647
Target
- Target
- Human KRT5 / CK5 / Cytokeratin 5
- Antigen Species
- Human
- Gene Name
- KRT5
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence in the middle region of human Cytokeratin 5 (286-317 aa KVELEAKVDALMDEINFMKMFFDAELSQMQTH), different from the related mouse sequence by one amino acid, and identical to the related rat sequence.
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl
