
Western blot analysis of extracts of various cell lines, using KRT4 antibody at 1:3000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 15s.
KRT4 / CK4 / Cytokeratin 4 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human |
| Format: | Liquid |
$281.00each
Catalog Number: LS-C747330-20
Catalog Number: LS-C747330
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Cytokeratin 4 antibody LS-C747330 is an unconjugated rabbit polyclonal antibody to human Cytokeratin 4 (KRT4 / CK4). Validated for WB.
- Application
- WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- CK-4 | CK4 | Cytokeratin 4 | Cytokeratin-4 | K4 | Keratin 4 | Type-II keratin Kb4 | CYK4 | Keratin-4 | KRT4
- UniProt Number
- P19013
- NCBI GenBank
- CAA30534.1 | X07695
- SwissProt
- P19013
Recommended Dilution
| Application | Dilution |
|---|---|
| WB | 1:500 - 1:2000 |
Target
- Target
- Human KRT4 / CK4 / Cytokeratin 4
- Antigen Species
- Human
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Human
Immunogen
- Immunogen
- Recombinant fusion protein containing a sequence corresponding to amino acids 446-520 of human KRT4 (NP_002263.3). EEYRMSGECQSAVSISVVSGSTSTGGISGGLGSGSGFGLSSGFGSGSGSGFGFGGSVSGSSSSKIISTTTLNKRR
- Immunogen Type
- Fusion Protein (e.g., GST, MBP tag)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Volume
- 20 Microliter
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS
