KRT19 / CK19 / Cytokeratin 19 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Lyophilized |
$587.00each
Catalog Number: LS-C490387-100
Catalog Number: LS-C490387
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Cytokeratin 19 antibody LS-C490387 is an unconjugated rabbit polyclonal antibody to Cytokeratin 19 (KRT19 / CK19) from human. It is reactive with human, mouse and rat. Validated for IHC and WB.
- Application
- IHC, IHC-P, WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- CK19 | Cytokeratin 19 | Cytokeratin-19 | Keratin 19 | KRT19 | Keratin-19 | CK-19 | K19 | K1CS | Keratin, type I, 40-kd
- Recommended Dilution: IHC-P
- 0.5 - 1 µg/ml
- Recommended Dilution: WB
- 0.1 - 0.5 µg/ml
- UniProt Number
- P08727
- NCBI GenBank
- NM_002276 | NP_002267.2
- SwissProt
- P08727
Target
- Target
- Human KRT19 / CK19 / Cytokeratin 19
- Antigen Species
- Human
- Gene Name
- KRT19
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- Amino acids QLAHIQALISGIEAQLGDVRADSERQNQEYQRLMDIKSR of human KRT19 were used as the immunogen for the CK19 antibody.
- Immunogen Type
- Peptide
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS