
Western blot testing of human 1) HeLa and 2) HepG2 cell lysate with KPNA2 antibody at 0.5ug/ml. Predicted molecular weight: ~58 kDa.
KPNA2 / Importin Alpha 1 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human |
| Format: | Lyophilized |
$587.00each
Catalog Number: LS-C782040-100
Catalog Number: LS-C782040
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Importin Alpha 1 antibody LS-C782040 is an unconjugated rabbit polyclonal antibody to human Importin Alpha 1 (KPNA2). Validated for WB.
- Application
- WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- Importin alpha 2 | Importin subunit alpha-2 | IPOA1 | Importin alpha-2 subunit | Karyopherin subunit alpha-2 | KPNA2 | Importin-alpha-P1 | Qip2 | RAG cohort 1 | SRP1 | RCH1 | SRP1-alpha | SRP1alpha | Importin alpha 1 | Pendulin | RAG cohort protein 1
- UniProt Number
- P52292
- NCBI GenBank
- NM_002266 | NP_002257.1
- SwissProt
- P52292
Recommended Dilution
| Application | Dilution |
|---|---|
| WB | 0.5 - 1 µg/ml |
Target
- Target
- Human KPNA2 / Importin Alpha 1
- Antigen Species
- Human
- Gene Name
- KPNA2
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Human
Immunogen
- Immunogen
- Amino acids 2-46 (STNENANTPAARLHRFKNKGKDSTEMRRRRIEVNVELRKAKKDDQ) were used as the immunogen for the KPNA2 antibody.
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles.
- Recommended Storage Buffer
- PBS
