Western blot testing of 1) rat lymph, 2) rat spleen and 3) mouse thymus tissue lysate with NKG2D antibody at 0.5ug/ml. Predicted molecular weight ~25 kDa (unmodified), ~35 kDa (glycosylated).
KLRK1 / CD314 / NKG2D Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Mouse, Rat |
| Format: | Lyophilized |
$587.00each
Catalog Number: LS-C782054-100
Catalog Number: LS-C782054
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- NKG2D antibody LS-C782054 is an unconjugated rabbit polyclonal antibody to NKG2D (KLRK1 / CD314) from mouse. It is reactive with mouse and rat. Validated for WB.
- Application
- WB
- Reactivity
- Ms, Rt
- Predicted Reactivity
- Human
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- D12S2489E | CD314 antigen | KLR | KLRK1 | NK cell receptor D | NKG2D | NKG2-D | NKG2-D-activating NK receptor | CD314
- Recommended Dilution: WB
- 0.5 - 1 µg/ml
- UniProt Number
- P26718
- NCBI GenBank
- NM_007360 | NP_031386.2
- SwissProt
- P26718
Target
- Target
- Mouse KLRK1 / CD314 / NKG2D
- Antigen Species
- Mouse
- Gene Name
- KLRC4-KLRK1|KLRK1
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Human
Immunogen
- Immunogen
- Amino acids YQFFDESKNWYESQASCMSQNASLLKVYSKEDQDLLKLVKSYH from the human protein were used as the immunogen for the NKG2D antibody.
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from PBS, 2% Trehalose, 0.025% sodium azide
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles.
- Recommended Storage Buffer
- PBS