Western blot - Anti-NKG2D Picoband antibody
KLRK1 / CD314 / NKG2D Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C662662-100
Catalog Number: LS-C662662
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- NKG2D antibody LS-C662662 is an unconjugated rabbit polyclonal antibody to human NKG2D (KLRK1 / CD314). Validated for WB.
- Application
- WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- D12S2489E | CD314 antigen | KLR | KLRK1 | NK cell receptor D | NKG2D | NKG2-D | NKG2-D-activating NK receptor | CD314
- UniProt Number
- P26718
- NCBI GenBank
- NM_007360 | NP_031386.2
- SwissProt
- P26718
Target
- Target
- Human KLRK1 / CD314 / NKG2D
- Antigen Species
- Human
- Epitope
- Expressed in natural killer (NK) cells, CD8(+) alpha-beta and gamma-delta T-cells. Expressed on essentially all CD56+CD3- NK cells from freshly isolated PBMC. Expressed in interferon-producing killer dendritic cells (IKDCs).
- Gene Name
- KLRC4-KLRK1|KLRK1
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence of human NKG2D (YQFFDESKNWYESQASCMSQNASLLKVYSKEDQDLLKLVKSYH).
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
- Preservative
- Yes
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl