Human Apolipoprotein H Antibody (IgG) ELISA Kit (Sandwich ELISA)
Catalog Number: LS-F67372-1
1 plate / $591.00
Reactivity: Human
Detection Method Colorimetric
Format: 96-Well Strip Plate
IHC analysis of KLF4 using anti-KLF4 antibody. KLF4 was detected in paraffin-embedded section of rat small intestine tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2?g/ml rabbit anti-KLF4 Antibody overnight at 4?C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37?C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
KLF4 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C756373-100
Catalog Number: LS-C756373
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- KLF4 antibody LS-C756373 is an unconjugated rabbit polyclonal antibody to KLF4 from human. It is reactive with human, mouse and rat. Validated for IHC and WB.
- Application
- IHC-P, WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- EZF | GKLF | Kruppel-like factor 4 (gut) | Hezf | KLF4 | Krueppel-like factor 4
- Recommended Dilution: IHC-P
- 0.5 - 1 µg/ml
- Recommended Dilution: WB
- 0.1 - 0.5 µg/ml
- UniProt Number
- O43474
- NCBI GenBank
- NM_004235 | NP_004226.3
- SwissProt
- O43474
Target
- Target
- Human KLF4
- Antigen Species
- Human
- Epitope
- No cross reactivity with other proteins.
- Gene Name
- KLF4
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Human
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence of human KLF4 (EKTLRQAGAPNNRWREELSHMKRLPPVLPGRPYDLA).
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- After reconstitution, may be stored at 4°C for 1 month. For long-term storage and to avoid freeze-thaw cycles, aliquot and store at -20°C.
- Recommended Storage Buffer
- NaCl
