
Western blot testing of human 1) WISH and 2) HepG2 cell lysate with GPR54 antibody at 0.5ug/ml. Predicted molecular weight ~43 kDa.
KISS1R / GPR54 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human |
| Format: | Lyophilized |
$587.00each
Catalog Number: LS-C782105-100
Catalog Number: LS-C782105
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- GPR54 antibody LS-C782105 is an unconjugated rabbit polyclonal antibody to human GPR54 (KISS1R). Validated for WB.
- Application
- WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- AXOR12 | GPR54 | HOT7T175 | KISS-1R | KISS1 receptor | G protein-coupled receptor 54 | Metastin receptor | KISS1R | Rot7t175 | G-protein coupled receptor 54 | HH8 | Hypogonadotropin-1 | KiSS-1 receptor | Kisspeptins receptor
- UniProt Number
- Q969F8
- NCBI GenBank
- NM_032551 | NP_115940.2
- SwissProt
- Q969F8
Recommended Dilution
| Application | Dilution |
|---|---|
| WB | 0.5 - 1 µg/ml |
Target
- Target
- Human KISS1R / GPR54
- Antigen Species
- Human
- Gene Name
- KISS1R
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Human
Immunogen
- Immunogen
- Amino acids MLRHLGRVAVRPAPADSALQGQVLAERAGAVRAK were used as the immunogen for the GPR54 antibody.
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from PBS, 2% Trehalose, 0.025% sodium azide
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles.
- Recommended Storage Buffer
- PBS
