Western blot - Anti-KiSS1 receptor antibody
KISS1R / GPR54 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C662527-100
Catalog Number: LS-C662527
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- GPR54 antibody LS-C662527 is an unconjugated rabbit polyclonal antibody to human GPR54 (KISS1R). Validated for WB.
- Application
- WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- AXOR12 | GPR54 | HOT7T175 | KISS-1R | KISS1 receptor | G protein-coupled receptor 54 | Metastin receptor | KISS1R | Rot7t175 | G-protein coupled receptor 54 | HH8 | Hypogonadotropin-1 | KiSS-1 receptor | Kisspeptins receptor
- UniProt Number
- Q969F8
- NCBI GenBank
- NM_032551 | NP_115940.2
- SwissProt
- Q969F8
Target
- Target
- Human KISS1R / GPR54
- Antigen Species
- Human
- Epitope
- Most highly expressed in the pancreas, placenta and spinal cord, with lower-level of expression in peripheral blood leukocytes, kidney, lung, fetal liver, stomach, small intestine, testes, spleen, thymus, adrenal glands and lymph nodes. In the adult brain, expressed in the superior frontal gyrus, putamen, caudate nucleus, cingulate gyrus, nucleus accumbens, hippocampus, pons and amygdala, as well as the hypothalamus and pituitary. Expression levels are higher in early (7-9 weeks) than term placentas. Expression levels were increased in both early placentas and molar pregnancies and were reduced in choriocarcinoma cells. Expressed at higher levels in first trimester trophoblasts than at term of gestation. Also found in the extravillous trophoblast suggesting endocrine/paracrine activation mechanism.
- Gene Name
- KISS1R
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence of human KiSS1 receptor (MLRHLGRVAVRPAPADSALQGQVLAERAGAVRAK).
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
- Preservative
- Yes
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl