
KIAA0652 / ATG13 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human, Mouse |
| Format: | Lyophilized |
$587.00each
Catalog Number: LS-C490156-100
Catalog Number: LS-C490156
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- ATG13 antibody LS-C490156 is an unconjugated rabbit polyclonal antibody to ATG13 (KIAA0652) from human. It is reactive with human and mouse. Validated for WB.
- Application
- WB
- Reactivity
- Hu, Ms
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- Autophagy-related protein 13 | KIAA0652 | ATG13 | Autophagy related 13
- UniProt Number
- O75143
- NCBI GenBank
- NM_014741 | NP_001136145.1
- SwissProt
- O75143
Recommended Dilution
| Application | Dilution |
|---|---|
| WB | 0.1 - 0.5 µg/ml |
Target
- Target
- Human KIAA0652 / ATG13
- Antigen Species
- Human
- Gene Name
- ATG13
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- Amino acids MAEDLDSLPEKLAVHEKNVREFDAFVETLQ of human ATG13 were used as the immunogen for the ATG13 antibody.
- Immunogen Type
- Peptide
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS
