Keratocan antibody Western blot. All lanes: Anti Keratocan at 0.5 ug/ml. Lane 1: Mouse Testis Whole Cell Lysate at 40 ug. Lane 2: Mouse Skeletal Muscle Whole Cell Lysate at 40 ug. Lane 3: MCF-7 Whole Cell Lysate at 40 ug. Lane 4: A549 Whole Cell Lysate at 40 ug. Predicted band size: 40 kD. Observed band size: 50 kD.
KERA / Keratocan Antibody (aa77-109)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human, Mouse |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C407865-100
Catalog Number: LS-C407865
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Keratocan antibody LS-C407865 is an unconjugated rabbit polyclonal antibody to Keratocan (KERA) (aa77-109) from human. It is reactive with human and mouse. Validated for WB.
- Application
- WB
- Reactivity
- Hu, Ms
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- CNA2 | KERA | SLRR2B | Keratocan | KTN
- UniProt Number
- O60938
- NCBI GenBank
- NM_007035 | NP_008966.1
- SwissProt
- O60938
Target
- Target
- Human KERA / Keratocan
- Antigen Species
- Human
- Epitope
- Cornea. Increased expression in the stroma of keratoconus corneas. Also detected in trachea, and in low levels, in intestine, skeletal muscle, ovary, lung and putamen. .
- Gene Name
- KERA
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-Terminus of human Keratocan (77-109 aa YLQNNLIETIPEKPFENATQLRWINLNKNKITN), different from the related mouse sequence by two amino acids.
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl