Western blot - Anti-KDM5B/Jarid1B Picoband Antibody
KDM5B / JARID1B Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C662356-100
Catalog Number: LS-C662356
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- JARID1B antibody LS-C662356 is an unconjugated rabbit polyclonal antibody to human JARID1B (KDM5B). Validated for WB.
- Application
- WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- CT31 | JARID1B | KDM5B | Histone demethylase JARID1B | RBBP2H1A | Lysine-specific demethylase 5B | PUT1 | RBP2-H1 | Cancer/testis antigen 31 | PLU-1 | PLU1 | RBBP2H1
- UniProt Number
- Q9UGL1
- NCBI GenBank
- NM_006618 | NP_006609.3
- SwissProt
- Q9UGL1
Target
- Target
- Human KDM5B / JARID1B
- Antigen Species
- Human
- Epitope
- Ubiquitously expressed, with highest levels in testis. Down-regulated in melanoma and glioblastoma. Up-regulated in breast cancer (at protein level). .
- Gene Name
- KDM5B
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence in the middle region of human KDM5B (641-685 aa DVLDVVVASTVQKDMAIMIEDEKALRETVRKLGVIDSERMDFE LL), identical to the related mouse and rat sequences.
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl