Western blot - Anti-KCNQ1/Kv7.1 Picoband Antibody

KCNQ1 / KVLQT1 Antibody

Antibody:	Rabbit Polyclonal
Applications:	Immunohistochemistry (general), Western Blot
Reactivity:	Human
Format:	Lyophilized

$480.00each

Catalog Number: LS-C661951-100

Unit Size

Quantity

For bulk orders or custom formulations:

Description: KVLQT1 antibody LS-C661951 is an unconjugated rabbit polyclonal antibody to human KVLQT1 (KCNQ1). Validated for WB.
Application: IHC, WB
Reactivity: Hu
Intended Use: Research Use Only
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: ATFB1 | ATFB3 | KVLQT1 | LQT1 | KCNA9 | KQT-like 1 | Kv1.9 | ROMANO-WARD SYNDROME | LQT | SQT2 | JLNS1 | KCNA8 | KCNQ1 | Kv7.1 | RWS | WRS
UniProt Number: P51787
NCBI GenBank: NM_000218 | NP_000209.2
SwissProt: P51787

Target: Human KCNQ1 / KVLQT1
Antigen Species: Human
Epitope: Abundantly expressed in heart, pancreas, prostate, kidney, small intestine and peripheral blood leukocytes. Less abundant in placenta, lung, spleen, colon, thymus, testis and ovaries.
Gene Name: KCNQ1

Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human KCNQ1 (356-397 aa QQKQRQKHFNRQIPAAASLIQTAWRCYAAENPDSSTWKIYIR), different from the related mouse sequence by two amino acids, and from the related rat sequence by one amino acid.
Immunogen Type: Synthetic Peptide (Linear)

Conjugate/Label: Unconjugated
Format: Lyophilized
Formulation: Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
Preservative: Yes
Purification Method: Affinity Purified

Storage Conditions: At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
Recommended Storage Buffer: NaCl

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at: technical@vectorlabs.com.