Western blot analysis of extracts of various cell lines, using KCNMB1 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 90s.

KCNMB1 Antibody

Primary AntibodyLSBio Guarantee

Antibody:	Rabbit Polyclonal
Applications:	Western Blot
Reactivity:	Human
Format:	Liquid

$281.00each

Catalog Number: LS-C496931-20

Unit Size

Quantity

For bulk orders or custom formulations:

Overview

Description: KCNMB1 antibody LS-C496931 is an unconjugated rabbit polyclonal antibody to human KCNMB1. Validated for WB.
Application: WB
Reactivity: Hu
Intended Use: Research Use Only
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: BK beta | BK channel beta subunit | BK channel subunit beta-1 | BKbeta1 | Hslo-beta | K(VCA)beta | Maxi K channel beta subunit | Maxi K beta | Hbeta1 | SLO-BETA | Slo-beta-1 | BKbeta | K(VCA)beta-1 | KCNMB1 | Maxi K channel subunit beta-1
Recommended Dilution: WB: 1:200 - 1:2000
UniProt Number: Q16558
NCBI GenBank: NM_004137 | NP_004128.1
SwissProt: Q16558

Target

Target: Human KCNMB1
Antigen Species: Human
Gene Name: KCNMB1

Antibody

Host Species: Rabbit
Clonality: Polyclonal
Isotype: IgG

Immunogen

Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 30-102 of human KCNMB1 (NP_004128.1). TYYILVTTVLPLYQKSVWTQESKCHLIETNIRDQEELKGKKVPQYPCLWVNVSAAGRWAVLYHTEDTRDQNQQ
Immunogen Type: Fusion Protein (e.g., GST, MBP tag)