Western blot analysis of extracts of various cells.
KCNJ6 / GIRK2 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human, Mouse |
| Format: | Liquid |
$281.00each
Catalog Number: LS-C411437-20
Catalog Number: LS-C411437
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- GIRK2 antibody LS-C411437 is an unconjugated rabbit polyclonal antibody to GIRK2 (KCNJ6) from human. It is reactive with human and mouse. Validated for WB.
- Application
- WB
- Reactivity
- Hu, Ms
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- BIR1 | GIRK2 | HiGIRK2 | KATP2 | GIRK-2 | KATP-2 | KCNJ6 | KIR3.2 | Weaver | KCNJ7
- Recommended Dilution: WB
- 1:500 - 1:2000
- UniProt Number
- P48051
- NCBI GenBank
- NM_002240 | NP_002231.1
- SwissProt
- P48051
Target
- Target
- Human KCNJ6 / GIRK2
- Antigen Species
- Human
- Epitope
- Human KCNJ6 / GIRK2
- Gene Name
- KCNJ6
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- Recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human KCNJ6 (NP_002231.1). MAKLTESMTNVLEGDSMDQDVESPVAIHQPKLPKQARDDLPRHISRDRTKRKIQRYVRKDGKCNVHHGNVRETYRYLTDI
- Immunogen Type
- Fusion Protein (e.g., GST, MBP tag)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Volume
- 20 Microliter
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS