Kv1.4 antibody Western blot. All lanes: Anti Kv1.4 at 0.5 ug/ml. Lane 1: HELA Whole Cell Lysate at 40 ug. Lane 2: COLO320 Whole Cell Lysate at 40 ug. Lane 3: HT1080 Whole Cell Lysate at 40 ug. Lane 4: PANC Whole Cell Lysate at 40 ug. Predicted band size: 73 kD. Observed band size: 73 kD.
KCNA4 / Kv1.4 Antibody (aa609-647)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Human |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C408019-100
Catalog Number: LS-C408019
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Kv1.4 antibody LS-C408019 is an unconjugated rabbit polyclonal antibody to human Kv1.4 (KCNA4) (aa609-647). Validated for IHC and WB.
- Application
- IHC, IHC-P, WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- Cardiac potassium channel | HBK4 | HPCN2 | HUKII | KCNA4 | KV1.4 | KCNA4L | RK8 | Type A potassium channel | PCN2 | RHK1 | RK4 | KCNA8 | Potassium channel 2 | RCK4
- UniProt Number
- P22459
- NCBI GenBank
- NM_002233 | NP_002224.1
- SwissProt
- P22459
Target
- Target
- Human KCNA4 / Kv1.4
- Antigen Species
- Human
- Epitope
- Detected in heart ventricle. .
- Gene Name
- KCNA4
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-Terminus of human Kv1.4 (609-647 aa SEYLEMEEGVKESLCAKEEKCQGKGDDSETDKNNCSNAK), different from the related mouse sequence by two amino acids, and from the related rat sequence by one amino acid.
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl