KCNA3 antibody Western blot. All lanes: Anti KCNA3 at 0.5 ug/ml. Lane 1: Rat Brain Tissue Lysate at 50 ug. Lane 2: Mouse Brain Tissue Lysate at 50 ug. Lane 3: K562 Whole Cell Lysate at 40 ug. Lane 4: HELA Whole Cell Lysate at 40 ug. Lane 5: 22RV1 Whole Cell Lysate at 40 ug. Predicted band size: 64 kD. Observed band size: 55 kD.
KCNA3 / Kv1.3 Antibody (aa513-544)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Bovine, Hamster, Horse, Human, Mouse, Pig, Rabbit, Rat |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C407862-100
Catalog Number: LS-C407862
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Kv1.3 antibody LS-C407862 is an unconjugated rabbit polyclonal antibody to Kv1.3 (KCNA3) (aa513-544) from human. It is reactive with human, mouse, rat and other species. Validated for WB.
- Application
- WB
- Reactivity
- Bov, Ham, Hr, Hu, Ms, Por, Rb, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- HGK5 | HPCN3 | HUKIII | KCNA3 | KV1.3 | MK3 | HLK3 | HUK3 | Potassium channel 3 | Type n potassium channel | PCN3
- UniProt Number
- P22001
- NCBI GenBank
- NM_002232 | NP_002223.3
- SwissProt
- P22001
Target
- Target
- Human KCNA3 / Kv1.3
- Antigen Species
- Human
- Gene Name
- KCNA3
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-Terminus of human KCNA3 (513-544 aa EELRKARSNSTLSKSEYMVIEEGGMNHSAFPQ), identical to the related mouse and rat sequences.
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl