ASPH antibody Western blot. All lanes: Anti ASPH at 0.5 ug/ml. Lane 1: Rat Brain Tissue Lysate at 50 ug. Lane 2: Rat Liver Tissue Lysate at 50 ug. Lane 3: HELA Whole Cell Lysate at 40 ug. Lane 4: HEPG2 Whole Cell Lysate at 40 ug. Lane 5: HEPA Whole Cell Lysate at 40 ug. Predicted band size: 86 kD. Observed band size: 100 kD.
Junctin / ASPH Antibody (aa726-758)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Guinea Pig, Human, Mouse, Rat |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C407689-100
Catalog Number: LS-C407689
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- ASPH antibody LS-C407689 is an unconjugated rabbit polyclonal antibody to ASPH (Junctin) (aa726-758) from human. It is reactive with human, mouse, rat and other species. Validated for IHC and WB.
- Application
- IHC, IHC-P, WB
- Reactivity
- GP, Hu, Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- A beta H-J-J | AAH | ASP beta-hydroxylase | BAH | Aspartate beta-hydroxylase | CASQ2BP1 | Cardiac junctin | HAAH | Humbug | JCTN | Junctate | Junctin | ASPH
- UniProt Number
- Q12797
- NCBI GenBank
- NM_004318 | NP_004309.2
- SwissProt
- Q12797
Target
- Target
- Human Junctin / ASPH
- Antigen Species
- Human
- Epitope
- Isoform 1 is detected in all tissues tested. Isoform 8 is mainly expressed in pancreas, heart, brain, kidney and liver. Isoform 8 is expressed in kidney (at protein level). .
- Gene Name
- ASPH
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-Terminus of human ASPH (726-758 aa EVWQDASSFRLIFIVDVWHPELTPQQRRSLPAI), identical to the related mouse sequence.
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl