Western blot analysis of extracts of PC3 cells.
JUN / c-Jun Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunofluorescence, Immunohistochemistry (general), Western Blot |
| Reactivity: | Human, Mouse |
| Format: | Liquid |
$281.00each
Catalog Number: LS-C330871-20
Catalog Number: LS-C330871
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- C-Jun antibody LS-C330871 is an unconjugated rabbit polyclonal antibody to c-Jun (JUN) from human. It is reactive with human and mouse. Validated for IF, IHC and WB.
- Application
- IF, IHC, WB
- Reactivity
- Hu, Ms
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- Activator protein 1 | AP-1 | C-Jun | JUN | Jun proto-oncogene | p39 | Jun oncogene | Proto-oncogene c-Jun | AP1 | Enhancer-binding protein AP1 | G0s7 | Transcription factor AP-1 | v-jun
- Recommended Dilution: IF/ICC
- 1:20 - 1:50
- Recommended Dilution: IHC
- 1:50 - 1:200
- Recommended Dilution: WB
- 1:500 - 1:2000
- UniProt Number
- P05412
- NCBI GenBank
- NM_002228 | NP_002219.1
- SwissProt
- P05412
Target
- Target
- Human JUN / c-Jun
- Antigen Species
- Human
- Epitope
- Human JUN / c-Jun
- Gene Name
- JUN
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- Recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human JUN (NP_002219.1). MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLTSPDVGLLK
- Immunogen Type
- Fusion Protein (e.g., GST, MBP tag)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Volume
- 20 Microliter
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS