Western blot analysis of extracts of various cell lines, using JTB antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 60s.

JTB / PAR Antibody

Primary AntibodyLSBio Guarantee

Antibody:	Rabbit Polyclonal
Applications:	Western Blot
Reactivity:	Human, Rat
Format:	Liquid

$281.00each

Catalog Number: LS-C497135-20

Unit Size

Quantity

For bulk orders or custom formulations:

Overview

Description: PAR antibody LS-C497135 is an unconjugated rabbit polyclonal antibody to PAR (JTB) from human. It is reactive with human and rat. Validated for WB.
Application: WB
Reactivity: Hu, Rt
Intended Use: RUO
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: HSPC222 | HJT | JTB | PAR protein | Protein JTB | PAR | HJTB
Recommended Dilution: WB: 1:500 - 1:2000
UniProt Number: O76095
NCBI GenBank: NM_006694, NP_006685.1
SwissProt: O76095

Target

Target: Human JTB / PAR
Antigen Species: Hu
Gene Name: JTB

Antibody

Host Species: Rb
Clonality: Polyclonal
Isotype: IgG

Immunogen

Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 31-105 of human JTB (NP_006685.1). EAPVQEEKLSASTSNLPCWLVEEFVVAEECSPCSNFRAKTTPECGPTGYVEKITCSSSKRNEFKSCRSALMEQRL
Immunogen Type: Fusion-P