
Western blot testing of 1) mouse liver and 2) human A431 lysate with FBXL11 antibody at 0.5ug/ml. Predicted molecular weight ~133 kDa.
JHDM1A / KDM2A Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human, Mouse |
| Format: | Lyophilized |
$587.00each
Catalog Number: LS-C782072-100
Catalog Number: LS-C782072
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- KDM2A antibody LS-C782072 is an unconjugated rabbit polyclonal antibody to KDM2A (JHDM1A) from human. It is reactive with human and mouse. Validated for WB.
- Application
- WB
- Reactivity
- Hu, Ms
- Predicted Reactivity
- Rat
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- CXXC8 | FBL11 | DKFZP434M1735 | JHDM1A | F-box protein Fbl7 | F-box/LRR-repeat protein 11 | KIAA1004 | KDM2A | FBXL11 | Lysine-specific demethylase 2A | LILINA | SF-KDM2A | F-box protein Lilina | FBL7
- UniProt Number
- Q9Y2K7
- NCBI GenBank
- NM_012308 | NP_036440.1
- SwissProt
- Q9Y2K7
Recommended Dilution
| Application | Dilution |
|---|---|
| WB | 0.5 - 1 µg/ml |
Target
- Target
- Human JHDM1A / KDM2A
- Antigen Species
- Human
- Gene Name
- KDM2A
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Human
Immunogen
- Immunogen
- Amino acids KRTFDLEEKLHTNKYNANFVTFMEGKDFNVEYIQR from the human protein were used as the immunogen for the FBXL11 antibody.
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from PBS, 2% Trehalose, 0.025% sodium azide
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles.
- Recommended Storage Buffer
- PBS
