IVL / Involucrin Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human |
| Format: | Lyophilized |
$587.00each
Catalog Number: LS-C490386-100
Catalog Number: LS-C490386
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Involucrin antibody LS-C490386 is an unconjugated rabbit polyclonal antibody to human Involucrin (IVL). Validated for WB.
- Application
- WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- Involucrin | IVL
- Recommended Dilution: WB
- 0.1 - 0.5 µg/ml
- UniProt Number
- P07476
- NCBI GenBank
- NM_005547 | NP_005538.2
- SwissProt
- P07476
Target
- Target
- Human IVL / Involucrin
- Antigen Species
- Human
- Gene Name
- IVL
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- Amino acids QVQDIQPALPTKGEVLLPVEHQQQKQEVQWPPKHK of human Involucrin were used as the immunogen for the Involucrin antibody.
- Immunogen Type
- Peptide
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS