
Western blot testing of human SW620 cell lysate with ITLN1 antibody at 0.5ug/ml. Expected molecular weight: 35-40 kDa.
ITLN1 / Omentin Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Human |
| Format: | Lyophilized |
$587.00each
Catalog Number: LS-C781773-100
Catalog Number: LS-C781773
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Omentin antibody LS-C781773 is an unconjugated rabbit polyclonal antibody to human Omentin (ITLN1). Validated for IHC and WB.
- Application
- IHC-P, WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- Endothelial lectin HL-1 | Galactofuranose-binding lectin | HL1 | INTL | Intelectin-1 | ITLN-1 | LFR | HL-1 | Omentin | ITLN1 | HIntL | ITLN
- UniProt Number
- Q8WWA0
- NCBI GenBank
- NM_017625 | NP_060095.2
- SwissProt
- Q8WWA0
Recommended Dilution
| Application | Dilution |
|---|---|
| IHC-P | 1 - 2 µg/ml |
| WB | 0.5 - 1 µg/ml |
Target
- Target
- Human ITLN1 / Omentin
- Antigen Species
- Human
- Gene Name
- ITLN1
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Human
Immunogen
- Immunogen
- Amino acids TDEANTYFKEWTCSSSPSLPRSCKEIKDECPSAFDGLYFLR were used as the immunogen for the ITLN1 antibody.
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at 4°C. After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS
