Western blot - Anti-ITLN1/Omentin Picoband Antibody
ITLN1 / Omentin Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Human |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C662291-100
Catalog Number: LS-C662291
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Omentin antibody LS-C662291 is an unconjugated rabbit polyclonal antibody to human Omentin (ITLN1). Validated for IHC and WB.
- Application
- IHC, IHC-P, WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- Endothelial lectin HL-1 | Galactofuranose-binding lectin | HL1 | INTL | Intelectin-1 | ITLN-1 | LFR | HL-1 | Omentin | ITLN1 | HIntL | ITLN
- UniProt Number
- Q8WWA0
- NCBI GenBank
- NM_017625 | NP_060095.2
- SwissProt
- Q8WWA0
Target
- Target
- Human ITLN1 / Omentin
- Antigen Species
- Human
- Epitope
- Highly expressed in omental adipose tissue where it is found in stromal vascular cells but not in fat cells but is barely detectable in subcutaneous adipose tissue (at protein level). Highly expressed in the small intestine. Also found in the heart, testis, colon, salivary gland, skeletal muscle, pancreas and thyroid and, to a lesser degree, in the uterus, spleen, prostate, lymph node and thymus. .
- Gene Name
- ITLN1
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-Terminus of human ITLN1 (19-59 aa TDEANTYFKEWTCSSSPSLPRSCKEIKDECPSAFDGLYFLR).
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl