Western blot testing of CD18 antibody and Lane 1: HeLa; 2: Jurkat; 3: HT1080; Predicted/Observed size: 85~95KD depending on glycosylation level
ITGB2 / CD18 Antibody (aa24-54)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Human |
| Format: | Lyophilized |
$587.00each
Catalog Number: LS-C388182-100
Catalog Number: LS-C388182
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- CD18 antibody LS-C388182 is an unconjugated rabbit polyclonal antibody to human CD18 (ITGB2) (aa24-54). Validated for IHC and WB.
- Application
- IHC, IHC-P, WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- CD18 antigen | CD18 | Integrin beta chain, beta 2 | ITGB2 | LCAMB | MAC-1 | MFI7 | MF17 | Integrin beta-2 | LAD | LFA-1
- UniProt Number
- P05107
- NCBI GenBank
- NM_000211 | NP_000202.3
- SwissProt
- P05107
Target
- Target
- Human ITGB2 / CD18
- Antigen Species
- Human
- Epitope
- Human ITGB2 / CD18
- Gene Name
- ITGB2
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- Synthetic peptide from the N-Terminus of human CD18 (ECTKFKVSSCRECIESGPGCTWCQKLNFTGPGDPD, aa24-54 of UniProt P05107). Percent identity by BLAST analysis: Human (100%); Mouse (87%); Rat, Ferret, Sheep, Goat (84%); Bovine, Rabbit, Zebu, Dog (81%).
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide/thimerosal.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Prior to reconstitution, 4°C. Following reconstitution store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS