ITGA2B antibody Western blot. All lanes: Anti ITGA2B at 0.5 ug/ml. Lane 1: Rat Lung Tissue Lysate at 50 ug. Lane 2: Rat Liver Tissue Lysate at 50 ug. Lane 3: Mouse Spleen Tissue Lysate at 50 ug. Predicted band size: 113 kD. Observed band size: 113 kD.
ITGA2B / CD41 Antibody (aa677-711)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C407859-100
Catalog Number: LS-C407859
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- CD41 antibody LS-C407859 is an unconjugated rabbit polyclonal antibody to CD41 (ITGA2B) (aa677-711) from human. It is reactive with human, mouse and rat. Validated for IHC and WB.
- Application
- IHC, IHC-P, WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- BDPLT2 | CD41B | GT | gp2B | Integrin alpha-IIb | ITGA2B | ITGAB | GPIIb | HPA3 | Platelet-specific antigen BAK | CD41 | CD41 antigen | GPalpha IIb | GTA
- UniProt Number
- P08514
- NCBI GenBank
- NM_000419 | NP_000410.2
- SwissProt
- P08514
Target
- Target
- Human ITGA2B / CD41
- Antigen Species
- Human
- Epitope
- Isoform 1 and isoform 2 were identified in platelets and megakaryocytes, but not in reticulocytes or in Jurkat and U-937 white blood cell line. Isoform 3 is expressed by leukemia, prostate adenocarcinoma and melanoma cells but not by platelets or normal prostate or breast epithelial cells.
- Gene Name
- ITGA2B
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-Terminus of human ITGA2B (677-711 aa EAELAVHLPQGAHYMRALSNVEGFERLICNQKKEN), different from the related mouse sequence by four amino acids.
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl