Human Apolipoprotein H Antibody (IgG) ELISA Kit (Sandwich ELISA)
Catalog Number: LS-F67372-1
1 plate / $591.00
Reactivity: Human
Detection Method Colorimetric
Format: 96-Well Strip Plate
Western blot analysis of extracts of human brain cell line, using IRF3 antibody.
IRF3 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human, Mouse |
| Format: | Liquid |
$281.00each
Catalog Number: LS-C331118-20
Catalog Number: LS-C331118
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- IRF3 antibody LS-C331118 is an unconjugated rabbit polyclonal antibody to IRF3 from human. It is reactive with human and mouse. Validated for WB.
- Application
- WB
- Reactivity
- Hu, Ms
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- Interferon regulatory factor 3 | IRF-3 | IRF3
- UniProt Number
- Q14653
- NCBI GenBank
- NM_001571 | NP_001562.1
- SwissProt
- Q14653
Target
- Target
- Human IRF3
- Antigen Species
- Human
- Epitope
- Human IRF3
- Gene Name
- IRF3
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- Recombinant fusion protein containing a sequence corresponding to amino acids 100-200 of human IRF3 (NP_001184051.1). PHDPHKIYEFVNSGVGDFSQPDTSPDTNGGGSTSDTQEDILDELLGNMVLAPLPDPGPPSLAVAPEPCPQPLRSPSLDNPTPFPNLGPSENPLKRLLVPGE
- Immunogen Type
- Fusion Protein (e.g., GST, MBP tag)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Volume
- 20 Microliter
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Short term: -20°C; Long term: -80°C; Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS
