IRF2 antibody Western blot. All lanes: Anti IRF2 at 0.5 ug/ml. Lane 1: Rat Intestine Tissue Lysate at 50 ug. Lane 2: SW620 Whole Cell Lysate at 40 ug. Lane 3: COLO320 Whole Cell Lysate at 40 ug. Lane 4: HELA Whole Cell Lysate at 40 ug. Lane 5: A549 Whole Cell Lysate at 40 ug. Predicted band size: 39 kD. Observed band size: 50 kD.

IRF2 Antibody (aa317-348)

Primary AntibodyLSBio Guarantee

Antibody:	Rabbit Polyclonal
Applications:	Western Blot
Reactivity:	Human, Rat
Format:	Lyophilized

$480.00each

Catalog Number: LS-C407857-100

Unit Size

Quantity

For bulk orders or custom formulations:

Overview

Description: IRF2 antibody LS-C407857 is an unconjugated rabbit polyclonal antibody to IRF2 (aa317-348) from human. It is reactive with human and rat. Validated for WB.
Application: WB
Reactivity: Hu, Rt
Intended Use: Research Use Only
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: IRF-2 | IRF2 | Interferon regulatory factor 2
UniProt Number: P14316
NCBI GenBank: NM_002199 | NP_002190.2
SwissProt: P14316

Target

Target: Human IRF2
Antigen Species: Human
Epitope: Expressed throughout the epithelium of the colon. Also expressed in lamina propria. .
Gene Name: IRF2

Antibody

Host Species: Rabbit
Clonality: Polyclonal

Immunogen

Immunogen: A synthetic peptide corresponding to a sequence at the C-Terminus of human IRF2 (317-348 aa MTPASSSSRPDRETRASVIKKTSDITQARVKS), different from the related mouse sequence by three amino acids.
Immunogen Type: Synthetic Peptide (Linear)

Format

Conjugate/Label: Unconjugated
Format: Lyophilized
Formulation: Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
Preservative: Yes
Purification Method: Affinity Purified

Storage & Handling

Storage Conditions: At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
Recommended Storage Buffer: NaCl