
Western blot analysis of SHIP using anti-SHIP antibody
INPP5D / SHIP1 / SHIP Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Human |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C662951-100
Catalog Number: LS-C662951
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- SHIP antibody LS-C662951 is an unconjugated rabbit polyclonal antibody to human SHIP (INPP5D / SHIP1). Validated for IHC and WB.
- Application
- IHC, IHC-P, WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- p150Ship | INPP5D | SHIP | SHIP1 | SHIP-1 | Hp51CN | SIP-145
- UniProt Number
- Q92835
- NCBI GenBank
- NM_005541 | NP_005532.2
- SwissProt
- Q92835
Target
- Target
- Human INPP5D / SHIP1 / SHIP
- Antigen Species
- Human
- Epitope
- Specifically expressed in immune and hematopoietic cells. Expressed in bone marrow and blood cells. Levels vary considerably within this compartment. Present in at least 74% of immature CD34+ cells, whereas within the more mature population of CD33+ cells, it is present in only 10% of cells. Present in the majority of T-cells, while it is present in a minority of B-cells (at protein level).
- Gene Name
- INPP5D
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence of human SHIP (NEDDKFTVQASEGVSMRFFTKLDQLIEFYKKENMGLVTHLQ).
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
- Preservative
- Yes
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl
