IL7R / CD127 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human, Rat |
| Format: | Lyophilized |
$587.00each
Catalog Number: LS-C490654-100
Catalog Number: LS-C490654
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- CD127 antibody LS-C490654 is an unconjugated rabbit polyclonal antibody to CD127 (IL7R) from human. It is reactive with human and rat. Validated for WB.
- Application
- WB
- Reactivity
- Hu, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- CD127 | CD127 antigen | IL-7RA | IL-7 receptor subunit alpha | IL7RA | ILRA | Interleukin 7 receptor | CDW127 | IL-7R subunit alpha | IL-7R-alpha | IL7R
- Recommended Dilution: WB
- 0.1 - 0.5 µg/ml
- UniProt Number
- P16871
- NCBI GenBank
- NM_002185 | NP_002176.2
- SwissProt
- P16871
Target
- Target
- Human IL7R / CD127
- Antigen Species
- Human
- Gene Name
- IL7R
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- Amino acids DHKKTLEHLCKKPRKNLNVSFNPESFLDCQIHRVDDIQ from IL7R alpha were used as the immunogen for the IL7R antibody.
- Immunogen Type
- Peptide
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS