IL21 Receptor Antibody
Catalog Number: LS-C349310
2 sizes / from $281.00
Antibody: Rabbit Polyclonal
Applications: Immunohistochemistry (general), Western Blot
Reactivity: Human, Mouse, Rat
Format: Liquid
IL21 Receptor Antibody (aa35-64)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Enzyme-Linked Immunosorbent Assay, Flow Cytometry, Immunohistochemistry (general) |
| Reactivity: | Mouse |
| Format: | Liquid |
$568.00each
Catalog Number: LS-C83985-200
Catalog Number: LS-C83985
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- IL21 Receptor antibody LS-C83985 is an unconjugated rabbit polyclonal antibody to mouse IL21 Receptor (aa35-64). Validated for ELISA, Flow and IHC.
- Application
- ELISA, FC, IHC
- Reactivity
- Ms
- Predicted Reactivity
- Rat
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- CD360 | IL21R | Interleukin 21 receptor | Interleukin-21 receptor | NILR | IL-21 receptor | CD360 antigen | IL-21R | IL21 Receptor | Novel interleukin receptor
- UniProt Number
- Q9HBE5
- NCBI GenBank
- NM_021798 | NP_068570.1
- SwissProt
- Q9HBE5
Recommended Dilution
| Application | Dilution |
|---|---|
| ELISA | 1:50000 |
| FC | 1:25 |
| IHC | 1:250 |
Target
- Target
- Mouse IL21 Receptor
- Antigen Species
- Mouse
- Epitope
- This F(ab')2 antibody recognizes mouse interleukin-21 receptor and the peptide sequence is less than 50% similar to other sequences in GenBank in this region. CI0156 was not tested for cross-reactivity to human IL-21 receptor.
- Gene Name
- IL21R
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Origin Species
- Human
Immunogen
- Immunogen
- Synthetic peptide CVLETRSPNPSILSLTWQDEYEELQDQETF corresponding to 35-65 residues of N-Terminus of mouse IL-21 receptor. Percent identity by BLAST analysis: Mouse (100%); Rat (90%).
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- 10 mM Potassium Phosphate, 140 mM NaCl, 1 mg/ml BSA, 0.1% Sodium Azide
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Aliquot to avoid freeze/thaw cycles.
- Recommended Storage Buffer
- 10 mM Potassium Phosphate|140 mM NaCl
