IL21 Antibody (aa40-68)

Antibody:	Goat Polyclonal
Applications:	Enzyme-Linked Immunosorbent Assay, Immunohistochemistry (general), Immunohistochemistry, Paraffin
Reactivity:	Human
Format:	Liquid

$436.00each

Catalog Number: LS-C187848-50

Unit Size

Quantity

For bulk orders or custom formulations:

Description: IL21 antibody LS-C187848 is an unconjugated goat polyclonal antibody to human IL21 (aa40-68). Validated for ELISA and IHC.
Application: ELISA, IHC, IHC-P
Reactivity: Hu
Intended Use: Research Use Only
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: IL21 | Interleukin 21 | Interleukin-21 | Interleukin-21 isoform | Za11 | IL-21
Recommended Dilution: ELISA: 1:50000
UniProt Number: Q9HBE4
NCBI GenBank: NM_021803 | NP_068575.1
SwissProt: Q9HBE4

Target: Human IL21
Antigen Species: Human
Epitope: Recognizes human interleukin-21, also known as IL-21 or Za11. IL-21 is a, a 155 amino acid pro-cytokine, reduced to 133 amino acids in the secreted mature form. IL-21 is a potent immunoregulatory cytokine and member of the IL-15/IL-21 family, expressed and secreted by activated CD4+ T cells. Two potential isoforms are generated by alternative splicing and differing is sequence at the C-terminus. Recognizes an epitope within the N-terminal (NT) region of human interleukin-21 (IL-21) and is expected to bind both isoforms. IL-21 enhances the proliferation/differentiation of stimulated B-cells, the proliferation of bone marrow progenitor cells, and increases the activity of NK cells and disease-specific CD8+ T-cells. IL-21 signals through binding to the specific type I cytokine receptor IL-21R, coupled with the common cytokine receptor g chain (gc), initiating the activation of the JAK/STAT signalling pathway. Is suitable for use in immunocytochemistry on human spleen or tonsil cells.
Gene Name: IL21

Immunogen: Synthetic peptide C-RQLIDIVDQLKNYVNDLVPEFLPAPEDVE corresponding to amino acids 40-68 within the N-Terminus of human IL-21. Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan (100%); Gibbon, Monkey, Marmoset (97%); Sheep, Bovine, Horse (93%); Elephant, Dog (90%); Panda, Cat, Pig (83%).
Immunogen Type: Synthetic Peptide (Linear)