Human Apolipoprotein H Antibody (IgG) ELISA Kit (Sandwich ELISA)
Catalog Number: LS-F67372-1
1 plate / $591.00
Reactivity: Human
Detection Method Colorimetric
Format: 96-Well Strip Plate
Western Blot: IL17RE Antibody (46N8G7) - Analysis of IL-17RE using a partial recombinant protein (amino acids 97-199) probed with IL-17RE antibody at 5 ug/ml. Goat anti-mouse Ig HRP secondary antibody and PicoTect ECL substrate solution were used for this test.
IL17RE Antibody (clone 46N8G7)
Primary AntibodyLSBio Guarantee
| Antibody: | Mouse Monoclonal |
| Applications: | Western Blot |
| Reactivity: | Human |
| Format: | Liquid |
$394.00each
Catalog Number: LS-C359462-0.1
Catalog Number: LS-C359462
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- IL17RE antibody LS-C359462 is an unconjugated mouse monoclonal antibody to human IL17RE. Validated for WB.
- Application
- WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Monoclonal Antibodies
- Alternative Names
- IL-17RE | IL17RE | IL-17 receptor E | Interleukin 17 receptor E | Interleukin-17 receptor E
- UniProt Number
- Q8NFR9
- NCBI GenBank
- NM_153480 | NP_705613.1
- SwissProt
- Q8NFR9
Target
- Target
- Human IL17RE
- Antigen Species
- Human
- Epitope
- Human IL17RE
- Gene Name
- IL17RE
Antibody
- Host Species
- Mouse
- Clonality
- Monoclonal
- Clone
- 46N8G7
- Isotype
- IgG1
- Light Chain
- Kappa Light Chain
Immunogen
- Immunogen
- Amino acids (97-199) MVHLLVQkSkkSSTFkFYRRHkMPAPAQRkLLPRRHLSEkSHHISIPSPDISHkGLRSkR~TQPSDPETWESLPRLDSQRHGGPEFSFDLLPEARAIRVTISSGPE
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- PBS, 0.05% Sodium Azide, 0.05% BSA
- Concentration
- 0.5 mg/mL
- Preservative
- Yes
- Purification Method
- Protein G Affinity
Storage & Handling
- Storage Conditions
- Short term: store at 4°C. Long term: aliquot and store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS
