IL-22BP / IL22RA2 Antibody (aa33-60)
Primary AntibodyLSBio Guarantee
| Antibody: | Goat Polyclonal |
| Applications: | Enzyme-Linked Immunosorbent Assay, Immunohistochemistry (general) |
| Reactivity: | Human, Non-Human Primate |
| Format: | Liquid |
$568.00each
Catalog Number: LS-C83979-200
Catalog Number: LS-C83979
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- IL22RA2 antibody LS-C83979 is an unconjugated goat polyclonal antibody to IL22RA2 (IL-22BP) (aa33-60) from human. It is reactive with human and monkey. Validated for ELISA.
- Application
- ELISA, IHC
- Reactivity
- Hu, NHP
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- Class II cytokine receptor | IL-22BP | IL-22RA2 | IL22RA2 | IL-22R-alpha-2 | Interleukin 22-binding protein | Interleukin-22-binding protein | CRF2-10 | CRF2-S1 | CRF2X | IL-22 receptor subunit alpha-2 | IL22BP | ZcytoR16
- Recommended Dilution: ELISA
- 1:50000
- UniProt Number
- Q969J5
- NCBI GenBank
- NM_052962 | NP_443194.1
- SwissProt
- Q969J5
Target
- Target
- Human IL-22BP / IL22RA2
- Antigen Species
- Human
- Epitope
- This antibody recognizes the N-terminus region of human interleukin-22 receptor alpha-2 chain precursor (IL-22R-alpha-2) which is also known as IL-22-binding protein (IL22BP), cytokine receptor family class II member 10 (CRF2-10), and cytokine receptor family type 2, soluble 1 (CRF2-S1). This antibody is likely to recognize rat and mouse IL-22 RA2 protein due to sequence similarity. The peptide sequence is <50 % identical to other sequences in GenBank.
- Gene Name
- IL22RA2
Antibody
- Host Species
- Goat
- Clonality
- Polyclonal
- Origin Species
- Human
Immunogen
- Immunogen
- Synthetic peptide RVQFQSRNFHNILQWQPGRALTGNSSVY-C corresponding to 33-60 residues of N-Terminus of human IL-22R-alpha-2 protein with cysteine added for conjugation to a carrier protein. Percent identity by BLAST analysis: Human, Gorilla, Monkey (100%); Gibbon (96%); Marmoset (89%); Dog (82%).
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- 10mM KHPO4, 140mM NaCl, 1mg/ml BSA, 0.1% sodium azide
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Aliquot to avoid freeze/thaw cycles.
- Recommended Storage Buffer
- 140mM NaCl