
Western blot testing of 1) mouse spleen and 2) human PANC-1 lysate with IL1B antibody at 0.5ug/ml. Predicted molecular weight ~31 kDa.
IL-1B / IL-1 Beta Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human, Mouse |
| Format: | Lyophilized |
$587.00each
Catalog Number: LS-C782826-100
Catalog Number: LS-C782826
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- IL-1 Beta antibody LS-C782826 is an unconjugated rabbit polyclonal antibody to IL-1 Beta (IL-1B) from human. It is reactive with human and mouse. Validated for WB.
- Application
- WB
- Reactivity
- Hu, Ms
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- IL-1B | IL1B | IL-1 beta | IL1-BETA | Preinterleukin 1 beta | Pro-interleukin-1-beta | Catabolin | IL-1 | IL1F2 | Interleukin 1, beta | Interleukin-1 beta
- UniProt Number
- P01584
- NCBI GenBank
- NM_000576 | NP_000567.1
- SwissProt
- P01584
Recommended Dilution
| Application | Dilution |
|---|---|
| WB | 0.5 - 1 µg/ml |
Target
- Target
- Human IL-1B / IL-1 Beta
- Antigen Species
- Human
- Gene Name
- IL1B
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Human
Immunogen
- Immunogen
- Amino acids DPKQYPKKKMEKRFVFNKIEVKSKVEFESAE were used as the immunogen for the IL1B antibody.
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles.
- Recommended Storage Buffer
- PBS
