
Immunofluorescence analysis of HeLa cells using IL1B antibody at dilution of 1:100. Blue: DAPI for nuclear staining.
IL-1B / IL-1 Beta Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunofluorescence, Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Liquid |
$281.00each
Catalog Number: LS-C746953-20
Catalog Number: LS-C746953
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- IL-1 Beta antibody LS-C746953 is an unconjugated rabbit polyclonal antibody to IL-1 Beta (IL-1B) from human. It is reactive with human, mouse and rat. Validated for IF and WB.
- Application
- IF, WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- IL-1B | IL1B | IL-1 beta | IL1-BETA | Preinterleukin 1 beta | Pro-interleukin-1-beta | Catabolin | IL-1 | IL1F2 | Interleukin 1, beta | Interleukin-1 beta
- Recommended Dilution: IF/ICC
- 1:50 - 1:200
- Recommended Dilution: WB
- 1:500 - 1:2000
- UniProt Number
- P01584
- NCBI GenBank
- NM_000576 | NP_000567.1
- SwissProt
- P01584
Target
- Target
- Human IL-1B / IL-1 Beta
- Antigen Species
- Human
- Gene Name
- IL1B
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Human
Immunogen
- Immunogen
- Recombinant fusion protein containing a sequence corresponding to amino acids 124-223 of human IL1B (NP_000567.1). CTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEIN
- Immunogen Type
- Fusion Protein (e.g., GST, MBP tag)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Volume
- 20 Microliter
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS
