Western blot - Anti-IL1 beta Picoband Antibody
IL-1B / IL-1 Beta Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Mouse |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C661920-100
Catalog Number: LS-C661920
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- IL-1 Beta antibody LS-C661920 is an unconjugated rabbit polyclonal antibody to mouse IL-1 Beta (IL-1B). Validated for WB.
- Application
- WB
- Reactivity
- Ms
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- IL-1B | IL1B | IL-1 beta | IL1-BETA | Preinterleukin 1 beta | Pro-interleukin-1-beta | Catabolin | IL-1 | IL1F2 | Interleukin 1, beta | Interleukin-1 beta
- UniProt Number
- P01584
- NCBI GenBank
- NM_000576 | NP_000567.1
- SwissProt
- P01584
Target
- Target
- Mouse IL-1B / IL-1 Beta
- Antigen Species
- Mouse
- Epitope
- Expressed in activated macrophages (at protein level).
- Gene Name
- IL1B
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence of mouse IL1 beta (DPKQYPKKKMEKRFVFNKIEVKSKVEFESAE).
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl