Flow Cytometry analysis of U87 cells using anti-IKK gamma antibody. Overlay histogram showing U87 cells stained with anti-IKK gamma antibody (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-IKK gamma Antibody (1µg/10E6 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (5-10µg/10E6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1µg/10E6 cells) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
IKBKG / NEMO / IKK Gamma Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C662596-100
Catalog Number: LS-C662596
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- IKK Gamma antibody LS-C662596 is an unconjugated rabbit polyclonal antibody to human IKK Gamma (IKBKG / NEMO). Validated for WB.
- Application
- WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- AMCBX1 | FIP3 | Fip3p | IkappaB kinase gamma | IKKgamma | IKK-gamma | NEMO | NF-kappa-B essential modifier | I-kappa-B kinase gamma-subunit | I-kappa-B kinase subunit gamma | IkB kinase gamma subunit | IKBKG | IKKAP1 | Incontinentia pigmenti | IP2 | IPD2 | NF-kappa-B essential modulator | ZC2HC9 | FIP-3 | IkB kinase subunit gamma | IKKG | IP1 | NFkappaB essential modulator
- UniProt Number
- Q9Y6K9
- NCBI GenBank
- NM_003639 | NP_003630.1
- SwissProt
- Q9Y6K9
Target
- Target
- Human IKBKG / NEMO / IKK Gamma
- Antigen Species
- Human
- Epitope
- Heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas.
- Gene Name
- IKBKG
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence in the middle region of human IKK gamma (207-246 aa QSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIK), different from the related mouse and rat sequences by three amino acids.
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl