Human Kidney: Formalin-Fixed, Paraffin-Embedded (FFPE)

IHC-plus™ transmembrane channel-like 1 Antibody

Primary AntibodyLSBio Guarantee

Antibody:	Rabbit Polyclonal
Applications:	Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot
Reactivity:	Human, Mouse, Rat
Format:	Liquid

$383.00each

Catalog Number: LS-B14299-50

Unit Size

Quantity

For bulk orders or custom formulations:

Description: Transmembrane channel-like 1 antibody LS-B14299 is an unconjugated rabbit polyclonal antibody to transmembrane channel-like 1 from human. It is reactive with human, mouse and rat. Validated for IHC and WB. Tested on 20 paraffin-embedded human tissues.
Application: IHC, IHC-P, WB
Reactivity: Hu, Ms, Rt
Intended Use: Research Use Only
Guarantees: This product carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Recommended Dilution: IHC-P: 1:100
Recommended Dilution: WB: 1:500 - 1:2000
UniProt Number: Q8TDI8
SwissProt: Q8TDI8

Immunogen: A synthetic peptide corresponding to a sequence within amino acids 600-700 of human TMC1 (NP_619636.2). INILRLHTSMYFQCWAVMCCNVPEARVFKASRSNNFYLGMLLLILFLSTMPVLYMIVSLPPSFDCGPFSGKNRMFEVIGETLEHDFPSWMAKILRQLSNPG
Immunogen Type: Synthetic Peptide (Linear)