TPH1 / Tryptophan Hydroxylase Antibody
Catalog Number: LS-C132713-100
100 µg / $576.00
Antibody: Mouse Monoclonal
Applications: Western Blot
Reactivity: Human, Rabbit, Rat
Format: Lyophilized
Human Colon: Formalin-Fixed, Paraffin-Embedded (FFPE)
IHC-plus™ TPH1 / Tryptophan Hydroxylase Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Liquid |
$470.00each
Catalog Number: LS-B14377-50
Catalog Number: LS-B14377
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Tryptophan Hydroxylase antibody LS-B14377 is an unconjugated rabbit polyclonal antibody to Tryptophan Hydroxylase (TPH1) from human. It is reactive with human, mouse and rat. Validated for IHC and WB. Tested on 20 paraffin-embedded human tissues.
- Application
- IHC, IHC-P, WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This product carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- L-tryptophan hydroxylase | TPH1 | TRPH | Tryptophan 5-hydroxylase 1 | Tryptophan 5-monooxygenase 1 | TPRH | Tryptophan hydroxylase 1 | TPH
- Recommended Dilution: IHC
- 1:50 - 1:200
- Recommended Dilution: IHC-P
- 1:100 - 1:200
- Recommended Dilution: WB
- 1:500 - 1:2000
- UniProt Number
- P17752
- NCBI GenBank
- NM_004179 | NP_004170.1
- SwissProt
- P17752
Target
- Target
- TPH1 / Tryptophan Hydroxylase
- Antigen Species
- Human
- Specificity
- Human TPH1 / TPH
- Epitope
- Human TPH1 / TPH
- Gene Name
- TPH1
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Origin Species
- Human
Immunogen
- Immunogen
- Recombinant fusion protein containing a sequence corresponding to amino acids 345-444 of human TPH1 (NP_004170.1). LSGHAKVKPFDPKITCKQECLITTFQDVYFVSESFEDAKEKMREFTKTIKRPFGVKYNPYTRSIQILKDTKSITSAMNELQHDLDVVSDALAKVSRKPSI
- Immunogen Type
- Fusion Protein (e.g., GST, MBP tag)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Concentration
- 2.135 mg/mL
- Volume
- 50 Microliter
- Animal Free
- No
- Carrier-Free
- Yes
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS
