Human Placenta: Formalin-Fixed, Paraffin-Embedded (FFPE)

IHC-plus™ TNFSF12 / TWEAK Antibody

Primary AntibodyLSBio Guarantee

Antibody:	Rabbit Polyclonal
Applications:	Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot
Reactivity:	Human, Mouse, Rat
Format:	Liquid

$383.00each

Catalog Number: LS-B13390-50

Unit Size

Quantity

For bulk orders or custom formulations:

Description: TWEAK antibody LS-B13390 is an unconjugated rabbit polyclonal antibody to TWEAK (TNFSF12) from human. It is reactive with human, mouse and rat. Validated for IHC and WB. Tested on 20 paraffin-embedded human tissues.
Application: IHC, IHC-P, WB
Reactivity: Hu, Ms, Rt
Intended Use: Research Use Only
Guarantees: This product carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: APO3/DR3 ligand | APO3L | DR3LG | TNFSF12 | APO3 ligand | TWEAK
Recommended Dilution: IHC: 1:50 - 1:200
Recommended Dilution: IHC-P: 1:100
Recommended Dilution: WB: 1:500 - 1:2000
UniProt Number: O43508
NCBI GenBank: NM_003809 | NP_003800.1
SwissProt: O43508

Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 42-123 of human TNFSF12 (NP_003800.1). VSLGSRASLSAQEPAQEELVAEEDQDPSELNPQTEESQDPAPFLNRLVRPRRSAPKGRKTRARRAIAAHYEVHPRPGQDGAQ
Immunogen Type: Fusion Protein (e.g., GST, MBP tag)