PVRL2 / CD112 Antibody
Catalog Number: LS-C341599
2 sizes / from $364.00
Antibody: Rabbit Polyclonal
Applications: Immunofluorescence, Western Blot
Reactivity: Human
Format: Liquid
Human Small Intestine, Submucosal Plexus: Formalin-Fixed, Paraffin-Embedded (FFPE)
IHC-plus™ PVRL2 / CD112 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunofluorescence, Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Human |
| Format: | Liquid |
$470.00each
Catalog Number: LS-B15413-50
Catalog Number: LS-B15413
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- CD112 antibody LS-B15413 is an unconjugated rabbit polyclonal antibody to human CD112 (PVRL2). Validated for IF, IHC and WB. Tested on 20 paraffin-embedded human tissues.
- Application
- IF, IHC, IHC-P, WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This product carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- HVEB | Herpesvirus entry protein B | Poliovirus receptor-like 2 | PVRL2 | Nectin-2 | PRR2 | PVRR2 | CD112 | CD112 antigen | Herpes virus entry mediator B | Herpesvirus entry mediator B | NECTIN2
- Recommended Dilution: IF/ICC
- 1:50 - 1:200
- Recommended Dilution: IHC
- 1:50 - 1:200
- Recommended Dilution: IHC-P
- 1:200
- Recommended Dilution: WB
- 1:500 - 1:2000
- UniProt Number
- Q92692
- NCBI GenBank
- NM_002856 | NP_002847.1
- SwissProt
- Q92692
Target
- Target
- PVRL2 / CD112
- Antigen Species
- Human
- Specificity
- Human PVRL2 / CD112
- Epitope
- Human PVRL2 / CD112
- Gene Name
- NECTIN2
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Origin Species
- Human
Immunogen
- Immunogen
- Recombinant fusion protein containing a sequence corresponding to amino acids 382-479 of human PVRL2 (NP_002847.1). FILLRVRRRRKSPGGAGGGASGDGGFYDPKAQVLGNGDPVFWTPVVPGPMEPDGKDEEEEEEEEKAEKGLMLPPPPALEDDMESQLDGSLISRRAVYV
- Immunogen Type
- Fusion Protein (e.g., GST, MBP tag)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Concentration
- 1.22 mg/mL
- Volume
- 50 Microliter
- Animal Free
- No
- Carrier-Free
- Yes
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS
