Polyclonal Chicken GFP Antibody (clone IQGFP6 Polyclonal, WB)
Catalog Number: LS-C827997-50
50 µL (1 mg/mL) / $492.00
Antibody: Chicken Polyclonal
Applications: Enzyme-Linked Immunosorbent Assay, Western Blot
Format: Liquid
Immunohistochemistry of paraffin-embedded human liver injury tissue.
IHC-plus™ Polyclonal Rabbit anti-Human S100A12 Antibody (IHC, WB)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Human |
| Format: | Liquid |
$383.00each
Catalog Number: LS-B15412-50
Catalog Number: LS-B15412
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- S100A12 antibody LS-B15412 is an unconjugated rabbit polyclonal antibody to human S100A12. Validated for IHC and WB. Tested on 20 paraffin-embedded human tissues.
- Application
- IHC, IHC-P, WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This product carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- Calgranulin-C | CGRP | CAAF1 | ENRAGE | MRP-6 | MRP6 | Neutrophil S100 protein | Protein S100-A12 | S100A12 | CAGC | Calgranulin C | EN-RAGE | p6
- Recommended Dilution: IHC
- 1:50 - 1:200
- Recommended Dilution: IHC-P
- 1:200
- Recommended Dilution: WB
- 1:500 - 1:2000
- UniProt Number
- P80511
- NCBI GenBank
- NM_005621 | NP_005612.1
- SwissProt
- P80511
Target
- Target
- S100A12
- Antigen Species
- Human
- Specificity
- Human S100A12 / CGRP
- Epitope
- Human S100A12 / CGRP
- Gene Name
- S100A12
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Origin Species
- Human
Immunogen
- Immunogen
- Recombinant fusion protein containing a sequence corresponding to amino acids 1-92 of human S100A12 (NP_005612.1). MTKLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKDKAVIDEIFQGLDANQDEQVDFQEFISLVAIALKAAHYHTHKE
- Immunogen Type
- Fusion Protein (e.g., GST, MBP tag)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Volume
- 50 Microliter
- Animal Free
- No
- Carrier-Free
- Yes
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS
