Polyclonal Chicken GFP Antibody (clone IQGFP6 Polyclonal, WB)
Catalog Number: LS-C827997-50
50 µL (1 mg/mL) / $492.00
Antibody: Chicken Polyclonal
Applications: Enzyme-Linked Immunosorbent Assay, Western Blot
Format: Liquid
Anti-PTGIS antibody IHC of human prostate. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.
IHC-plus™ Polyclonal Rabbit anti-Bovine PGIS / PTGIS Antibody (aa299-329, IHC, WB)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Bovine, Human |
| Format: | Liquid |
$383.00each
Catalog Number: LS-B1615-1
Catalog Number: LS-B1615
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- PTGIS antibody LS-B1615 is an unconjugated rabbit polyclonal antibody to PTGIS (PGIS) (aa299-329) from bovine. It is reactive with human and bovine. Validated for IHC and WB.
- Application
- IHC, IHC-P, WB
- Reactivity
- Bov, Hu
- Intended Use
- Research Use Only
- Guarantees
- This product carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- CYP8A1 | Prostaglandin I2 synthase | Prostacyclin synthase | PTGI | PTGIS | CYP8 | PGIS
- Recommended Dilution: IHC-P
- 5 µg/ml
- UniProt Number
- Q16647
- NCBI GenBank
- NM_000961 | NP_000952.1
- SwissProt
- Q16647
Target
- Target
- PGIS / PTGIS
- Antigen Species
- Bovine
- Specificity
- Bovine amino acids 299-329 (LLKNPEALAAVRGELETVLLGAEQPISQMTT)1,2,3
- Epitope
- Bovine amino acids 299-329 (LLKNPEALAAVRGELETVLLGAEQPISQMTT)1,2,3
- Gene Name
- PTGIS
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Origin Species
- Human
Immunogen
- Immunogen
- Bovine PGIS amino acids 299-329 (LLKNPEALAAVRGELETVLLGAEQPISQMTT). Percent identity by BLAST analysis: Bovine (100%); Horse, Pig (87%); Gibbon, Monkey, Bat (83%); Human (80%).
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- TBS, pH 7.4, 0.02% Sodium Azide, 50% Glycerol, 0.5% BSA
- Animal Free
- No
- Carrier-Free
- No
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Short term: store at 4°C. Long term: store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- TBS
