Immunohistochemistry of paraffin-embedded human kidney using NDUFA13 antibody at dilution of 1:200 (x400 lens)

IHC-plus™ NDUFA13 / GRIM19 Antibody

Primary AntibodyLSBio Guarantee

Antibody:	Rabbit Polyclonal
Applications:	Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot
Reactivity:	Human, Mouse
Format:	Liquid

$383.00each

Catalog Number: LS-B14892-50

Unit Size

Quantity

For bulk orders or custom formulations:

Description: GRIM19 antibody LS-B14892 is an unconjugated rabbit polyclonal antibody to GRIM19 (NDUFA13) from human. It is reactive with human and mouse. Validated for IHC and WB. Tested on 20 paraffin-embedded human tissues.
Application: IHC, IHC-P, WB
Reactivity: Hu, Ms
Intended Use: Research Use Only
Guarantees: This product carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: B16.6 | CGI-39 | CI-B16.6 | Complex I-B16.6 | GRIM-19 | GRIM19 | CDA016 | Complex I B16.6 subunit | NDUFA13
Recommended Dilution: IHC: 1:50 - 1:200
Recommended Dilution: IHC-P: 1:200
Recommended Dilution: WB: 1:500 - 1:2000
NCBI GenBank: NM_015965

Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 52-144 of human NDUFA13 (NP_057049.5). KWNRERRRLQIEDFEARIALLPLLQAETDRRTLQMLRENLEEEAIIMKDVPDWKVGESVFHTTRWVPPLIGELYGLRTTEEALHASHGFMWYT
Immunogen Type: Fusion Protein (e.g., GST, MBP tag)