Human Colon: Formalin-Fixed, Paraffin-Embedded (FFPE)

IHC-plus™ GUCA2A / Guanylin Antibody

Primary AntibodyLSBio Guarantee

Antibody:	Rabbit Polyclonal
Applications:	Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot
Reactivity:	Human, Mouse, Rat
Format:	Liquid

$383.00each

Catalog Number: LS-B15574-50

Unit Size

Quantity

For bulk orders or custom formulations:

Description: Guanylin antibody LS-B15574 is an unconjugated rabbit polyclonal antibody to Guanylin (GUCA2A) from human. It is reactive with human, mouse and rat. Validated for IHC and WB. Tested on 20 paraffin-embedded human tissues.
Application: IHC, IHC-P, WB
Reactivity: Hu, Ms, Rt
Intended Use: Research Use Only
Guarantees: This product carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: GUCA2A | GCAP-I | Guanylate cyclase activator 2A | Guanylin | GUCA2 | STARA
Recommended Dilution: IHC-P: 1:200
Recommended Dilution: WB: 1:500 - 1:2000
UniProt Number: Q02747
SwissProt: Q02747

Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 22-115 of human GUCA2A (NP_291031.2). VTVQDGNFSFSLESVKKLKDLQEPQEPRVGKLRNFAPIPGEPVVPILCSNPNFPEELKPLCKEPNAQEILQRLEEIAEDPGTCEICAYAACTGC
Immunogen Type: Fusion Protein (e.g., GST, MBP tag)