Human Prostate: Formalin-Fixed, Paraffin-Embedded (FFPE)

IHC-plus™ GMPR1 / GMPR Antibody

Primary AntibodyLSBio Guarantee

Antibody:	Rabbit Polyclonal
Applications:	Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot
Reactivity:	Human, Mouse
Format:	Liquid

$383.00each

Catalog Number: LS-B16974-50

Unit Size

Quantity

For bulk orders or custom formulations:

Description: GMPR antibody LS-B16974 is an unconjugated rabbit polyclonal antibody to GMPR (GMPR1) from human. It is reactive with human and mouse. Validated for IHC and WB. Tested on 20 paraffin-embedded human tissues.
Application: IHC, IHC-P, WB
Reactivity: Hu, Ms
Intended Use: Research Use Only
Guarantees: This product carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: GMP reductase 1 | Gmp reductase | GMPR | GMPR1
Recommended Dilution: IHC-P: 5 µg/ml
Recommended Dilution: WB: 1:500 - 1:2000
UniProt Number: P36959
NCBI GenBank: NM_006877 | NP_006868.3
SwissProt: P36959

Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 60-120 of human GMPR (NP_006868.3). TFEMAAVMSQHSMFTAIHKHYSLDDWKLFATNHPECLQNVAVSSGSGQNDLEKMTSILEAV
Immunogen Type: Fusion Protein (e.g., GST, MBP tag)