Human Testis: Formalin-Fixed, Paraffin-Embedded (FFPE)

IHC-plus™ FAM20A Antibody

Antibody:	Rabbit Polyclonal
Applications:	Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot
Reactivity:	Human, Mouse, Rat
Format:	Liquid

$470.00each

Catalog Number: LS-B14923-50

Unit Size

Quantity

For bulk orders or custom formulations:

Description: FAM20A antibody LS-B14923 is an unconjugated rabbit polyclonal antibody to FAM20A from human. It is reactive with human, mouse and rat. Validated for IHC and WB. Tested on 20 paraffin-embedded human tissues.
Application: IHC, IHC-P, WB
Reactivity: Hu, Ms, Rt
Intended Use: Research Use Only
Guarantees: This product carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: AIGFS | FAM20A | FP2747 | Protein FAM20A
Recommended Dilution: IHC: 1:100 - 1:200
Recommended Dilution: IHC-P: 1:200
Recommended Dilution: WB: 1:500 - 1:2000
UniProt Number: Q96MK3
SwissProt: Q96MK3

Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 140-240 of human FAM20A (NP_060035.2). YREQMNLTSLDPPLQLRLEASWVQFHLGINRHGLYSRSSPVVSKLLQDMRHFPTISADYSQDEKALLGACDCTQIVKPSGVHLKLVLRFSDFGKAMFKPMR
Immunogen Type: Fusion Protein (e.g., GST, MBP tag)