Human Spleen: Formalin-Fixed, Paraffin-Embedded (FFPE)

IHC-plus™ CXCL7 / PPBP Antibody

Primary AntibodyLSBio Guarantee

Antibody:	Rabbit Polyclonal
Applications:	Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot
Reactivity:	Human
Format:	Liquid

$383.00each

Catalog Number: LS-B14379-50

Unit Size

Quantity

For bulk orders or custom formulations:

Description: PPBP antibody LS-B14379 is an unconjugated rabbit polyclonal antibody to human PPBP (CXCL7). Validated for IHC and WB. Tested on 20 paraffin-embedded human tissues.
Application: IHC, IHC-P, WB
Reactivity: Hu
Intended Use: Research Use Only
Guarantees: This product carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: Beta-thromboglobulin | B-TG1 | Beta-TG | C-X-C motif chemokine 7 | CTAP3 | CXCL7 | CTAP-III | CXC chemokine ligand 7 | NAP-2 | NAP-2-L1 | PBP | LA-PF4 | LDGF | SCYB7 | Small-inducible cytokine B7 | Small inducible cytokine B7 | THBGB1 | Thrombocidin 2 | TC2 | TGB | Thrombocidin 1 | Thromboglobulin, beta-1 | CTAPIII | MDGF | Platelet basic protein | PPBP | SCAR10 | TC1 | THBGB
Recommended Dilution: IHC: 1:50 - 1:100
Recommended Dilution: IHC-P: 1:200
Recommended Dilution: WB: 1:500 - 1:2000
UniProt Number: P02775
NCBI GenBank: NM_002704 | NP_002695.1
SwissProt: P02775

Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 31-128 of human PPBP (NP_002695.1). TALASSTKGQTKRNLAKGKEESLDSDLYAELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGDESAD
Immunogen Type: Fusion Protein (e.g., GST, MBP tag)